PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G185500.2
Common NameB456_008G185500, LOC105764557
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 329aa    MW: 35645.1 Da    PI: 7.3268
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G185500.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.41.4e-32162217156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Gorai.008G185500.2 162 KQRRCWSPELHRRFLHALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 217
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.185159219IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-29159220IPR009057Homeodomain-like
SuperFamilySSF466891.29E-18160220IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-27162217IPR006447Myb domain, plants
PfamPF002491.2E-7164215IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0055062Biological Processphosphate ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MSGGSTTTDY MQGQSDCSEQ TTSDVPVLEE FIPIKRSSNC SEEDDEQESH KSKETNVPAA  60
VDKRKSDWLR SVQLWNNNQS PDLPLNEDDG KIGSAIEVKK NGGAFQPFQK EKTVEMSGQS  120
AVGKTNGSAT STCTTESGSR GGEANNANKS KTEEKEGQAS RKQRRCWSPE LHRRFLHALQ  180
QLGGSHVATP KQIRELMKVD GLTNDEVKSH LQKYRLHTRR PSPTVHNNAN PQAPQFVVVG  240
GIWVPPPDYS TMTTTTTSTK TATVTPTSGI YTPVAAPLPA LPQPSGTMAQ RPQQSHSEER  300
GSHSEGRVQS NSPSISSSTH TTTDSPAF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00218DAPTransfer from AT1G68670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5264434e-61HQ526443.1 Gossypium herbaceum clone NBRI_D2_1421 simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012438639.10.0PREDICTED: transcription factor LUX-like
TrEMBLA0A0D2PWT60.0A0A0D2PWT6_G
TrEMBLA0A0D2T8310.0A0A0D2T831_G
STRINGVIT_01s0011g03110.t011e-124(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.17e-80G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]